PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G054100.2
Common NamePHAVU_003G054100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 295aa    MW: 31293.7 Da    PI: 7.4309
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G054100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.14e-131155345
                        SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                         W++e d+ + +a + ++ +   +Wk+Ia+ ++ g+tl+++k+++ 
  Phvul.003G054100.2 11 EWSKEQDKAFENALAIHPEDasdRWKKIAADVP-GKTLEEIKHHYE 55
                        7********************************.**********96 PP

2Myb_DNA-binding45.12.2e-14122166347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT++E++l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
  Phvul.003G054100.2 122 AWTEDEHKLFLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 166
                         6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.234762IPR017884SANT domain
SMARTSM007172.1E-10860IPR001005SANT/Myb domain
SuperFamilySSF466892.37E-111066IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-51155IPR009057Homeodomain-like
PfamPF002493.9E-101155IPR001005SANT/Myb domain
CDDcd001672.89E-101158No hitNo description
PROSITE profilePS5129417.07114171IPR017930Myb domain
SuperFamilySSF466891.05E-16117172IPR009057Homeodomain-like
SMARTSM007175.1E-11119169IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.7E-17119169IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.6E-11122165IPR009057Homeodomain-like
PfamPF002492.5E-12122166IPR001005SANT/Myb domain
CDDcd001671.31E-10122167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MTVDEVGSSS EWSKEQDKAF ENALAIHPED ASDRWKKIAA DVPGKTLEEI KHHYELLVED  60
VNQIESGCVP LPSYNYSSEG SAGHASDEGA GKKGGSSWNS NNESNHGNKA SRSDQERRKG  120
IAWTEDEHKL FLLGLEKYGK GDWRSISRNF VVTRTPTQVA SHAQKYFIRL NSMNKDRRRS  180
SIHDITSVNN GEVSAPQGPI TGQTNGSAAN SGKSTKPAPP TPTAAPSVGI YAAPTIGQPV  240
GGPLVSAVGT PVNLPTSAHM AYGLGGPVPV TVVPGAPMNL GPVPYPMPHT SAHR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-19774673RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0966930.0BT096693.1 Soybean clone JCVI-FLGm-25B10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153659.10.0hypothetical protein PHAVU_003G054100g
RefseqXP_007153660.10.0hypothetical protein PHAVU_003G054100g
SwissprotQ8S9H72e-63DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLV7C6C10.0V7C6C1_PHAVU; Uncharacterized protein
STRINGGLYMA08G40020.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-111MYB family protein